.
The Open Protein Structure Annotation Network
PDB Keyword
.

355058

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 355058
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS91114,YNL092W, BIG_646 Molecular Weight 45494.36 Da.
    Residues 400 Isoelectric Point 5.67
    Sequence mdenefdnqrenkavarviisflkyeeyalkeiynlrvkkwasisdrqkdmvpnytkylanlkaaiien gkffrsvaeyalqsisfepgeivqpndldmsktcslltqvyrewsaeaisernclnsrlvpflktlspp kadilipgcgtgrllvdlsrmgyncegnefsyhmllvsqymlnagllqnqiiiypfihcfshwkkiedq lspikvpdieawssnkgmgsmsicagsfvdcygrnqgtkisshytfsrrmqlsrakaenskdvvvtnff idtgsnildyldtighvlkpggiwcnfgpllyhfendhgvettyevnpysgfqdkindytplmglelss ddiisiatnhldfelirresgilcgygryagpescampgymchywilksnptnes
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch