.
The Open Protein Structure Annotation Network
PDB Keyword
.

355327

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 355327
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS91268,YGL017W Molecular Weight 57927.47 Da.
    Residues 503 Isoelectric Point 5.92
    Sequence msdrfviwapsmhnepaakcgychgnkggnmdqlfaldswahrymnkmdvvkienctigsfvehmdvat ydrmcnmgfrrsgkflykvdplrnccrlytirtapqelnmtkelkkcisrfatritsedycpaavassd fvgkivnaemnsktfytrfepalyseekyhlfvkyqekvhqdynnspksfkrflcdtpfgpeavlgtqe sweqlnnwqrmkpgeklkhmgpvhecyyyegkliaitvsdilpsgissvyfiwdpdyskwslgklsalr dlaiiqrtnlqyyylgyyiedcpkmnykanygaevldvchskyiplkpiqdmisrgklfvigeeetkvt kelylvdsetgrgegfptdnvvkykniaeeiygvggcafksanesalelkelygipyeeedldtiyhlk ehnghapngipnvvpgllplwelldimqsgkitdlegrlflfeietegirplinfyseppnvkkricdv irlfgfetcmkavilyseqm
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch