.
The Open Protein Structure Annotation Network
PDB Keyword
.

355496

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 355496
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS91416,YMR152W Molecular Weight 41635.22 Da.
    Residues 365 Isoelectric Point 7.63
    Sequence msdeivtnksvtyvnnttpvtitsseldlrscyqddevvievhaaalnpidfithqlcnsyifgkypkt ysrdysgviikagkdvdnrwkvgdkvngmyshiygergtlthylilnpakdvpithmvevpkdendpyd dfvyaaawpltfgtafstlydfkkdwtsdskvlvigastsvsyafvhiaknyfnigtvvgicsknsier nkklgydylvpydegsivenvkklkqsvlendkfdmifdsvgnhdffpvidqflkpkaknsfyvtiagn nkadykniswrdfvslssilkainpfkkynwrfghpyppnnfievgnemikkgtykppidsvyefdqyk eaidrlmsnrakgkvvvkmk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch