The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 355585
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS91590,10173228 Molecular Weight 11739.96 Da.
    Residues 107 Isoelectric Point 6.39
    Sequence mnvqastktyfignvddfpvklgrdisidgvkiavfklesgqikaiqnkcphkggplaegivsgehvfc plhdwkislqdgmvqypdegcvttfkttvtdgkvyvhm
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch