.
The Open Protein Structure Annotation Network
PDB Keyword
.

355604

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 355604
    Molecular Characteristics
    Source Deinococcus radiodurans r1
    Alias Ids TPS91628,6457826 Molecular Weight 23658.68 Da.
    Residues 210 Isoelectric Point 5.89
    Sequence msgpgtpfvigvaggsgsgkttvtrrvietvgregvavlnqdnyyrdqsdipfesrlhtnydhpaafdw allreqldallagvpiempeydftqhtraahttrvlpgrvvvlegffalydeelrsrmglkvfvdadad vrfirrllrdtqergrtpesvieqylgfvrpmhlsfveptkryadviiphggmnepaldmlaarirvma qrd
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch