.
The Open Protein Structure Annotation Network
PDB Keyword
.

355611

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 355611
    Molecular Characteristics
    Source Deinococcus radiodurans r1
    Alias Ids TPS91642,6459755 Molecular Weight 28490.76 Da.
    Residues 264 Isoelectric Point 5.33
    Sequence msvtidlsgktalvmgvanarslgwaiaeqllqagcrvgfsyqgerlkgelekltkdwpntwiqqadat seedmdalfarvkdefselhllvhsigfaprtamdgrfidttaddwntalnvsaytlvaaarraeplmp dggsiisltyhasqqvvprynvmgvakaaleaatrylaadlgereirvntisagpmrtiaarsiphfgk lynkgamnaafgrnatseevgklalfllsdlssgitgqtiyvdaglsimtvketaed
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch