.
The Open Protein Structure Annotation Network
PDB Keyword
.

355632

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 355632
    Molecular Characteristics
    Source Sulfolobus solfataricus p2
    Alias Ids TPS91680,13814347 Molecular Weight 30028.06 Da.
    Residues 266 Isoelectric Point 6.67
    Sequence mlldvetnedleliknsfneflsrewnkygskkhevsrdkimevfgkvkdlgifqfiretgltnallln eiigenllpgivafssmlgvdylvsvgvnyvaevdkaeaivtpkgisnkndvdveeiespdpsvrvyki iegewrksdfdfnkvillasaqiighatavlketveysknriafgkpigsyqaikhrivddalrielvr srylvnptsperifkhaykkafkailnsiqshggigftadldlhlhlkrvillgklfqq
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch