.
The Open Protein Structure Annotation Network
PDB Keyword
.

355641

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 355641
    Molecular Characteristics
    Source Thermoplasma acidophilum dsm 1728
    Alias Ids TPS91698,10639306 Molecular Weight 31602.77 Da.
    Residues 290 Isoelectric Point 8.46
    Sequence mdggfmqkkvllvglgvmgsriaanfasagklagvydrnvdkakntasmlkvgfyrdlgeavknsdiiv tmlyddrsvkevysqmeqgvqgkvfidmstispdtsieiakrikekggkmydapvigtsiavekkalvv lvggdlsgydevrdlisatanqvvymgdngsglyaklvnnlflgsymaslaeavrfgrkngipdstisd vltkyssarsptsdlkvpkmisedysvqfsiknmlkdmeivdrmasekrialpvaslalqlfrylmdsg ygeediaaiyralr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch