The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 355647
    Molecular Characteristics
    Source Thermoplasma acidophilum dsm 1728
    Alias Ids TPS91710,10640443, PF08069 Molecular Weight 16513.72 Da.
    Residues 145 Isoelectric Point 10.29
    Sequence marmhtrkrgrsgskkvygvqpswiqyskdevintivnlkksgvppsvigiklrdqygiptvkavlgmk lgkvlsekglkddvpedlgnlikrynnvakhvelnpkdqankrgrdlimakmlrlvkyykrtgvldekw nlskvlr
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch