.
The Open Protein Structure Annotation Network
PDB Keyword
.

355703

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 355703
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS91818,2634399 Molecular Weight 27964.56 Da.
    Residues 240 Isoelectric Point 6.35
    Sequence mtntipnwiklnneimiqkdgkyqfekdkeavhsyfvdyinqntvffhdlkekldylikndyyeeefls kytfeqiksiykiaysykfrfpsfmsafkfyndyalktndktkileryedrvsivalycadgdyekave evhtmmkqeyqpatptflnagrkrrgemvscfllevgdslndisraidismqlsklgggvalnlnklra kgeaikdvenatkgvvgvmklldnafryadqmg
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch