.
The Open Protein Structure Annotation Network
PDB Keyword
.

355722

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 355722
    Molecular Characteristics
    Source Caulobacter crescentus cb15
    Alias Ids TPS91852,13422701 Molecular Weight 38639.43 Da.
    Residues 350 Isoelectric Point 5.12
    Sequence mtddpevlirveknvgritlnrpkalhaltlgmcetmigalldwqddpevymvlidhtgergfcaggdi rmladsgakdgvearrffhteyqlnhllftyetpvvavmdgivmgggvgismpahiriaterttfampe tgiglfpdvgggwylprlpgkaglwlaltgarikgadcmrlgiathfvefgaveglkkaiiadprriee tlrkyradagkasllgfeqdlnrlfvgesveeifefltldssdwgkaqlevmktkspqtlkvafeqlkr gaamedfadnmameyrigsrvvmkhdfiegvravivdkdnaprwsparvedvtdaalaeifaplppgee wtplt
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch