.
The Open Protein Structure Annotation Network
PDB Keyword
.

355744

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 355744
    Molecular Characteristics
    Source Haemophilus influenzae rd kw20
    Alias Ids TPS91896,1573544 Molecular Weight 25909.18 Da.
    Residues 228 Isoelectric Point 5.40
    Sequence mteadlfvsqfltekltalfpnvpvlseenchisfeerknwkeywlidpldgtqqfinrtdqfsvlitl vrknkpvlsvihapilsttyyamcdfgtfkkqldqvkkltknttnfdrplriavgattsqekvrsilpk dfpcefvvvgssslksglvaegavdcyvrlgqtgewdtagaevllgethgaifdshfepltynqretli nphfvmvgdqsfdwrsifqfn
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch