.
The Open Protein Structure Annotation Network
PDB Keyword
.

355751

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 355751
    Molecular Characteristics
    Source Thermoplasma acidophilum dsm 1728
    Alias Ids TPS91906,16082052, 3.40.640.10 Molecular Weight 41579.19 Da.
    Residues 382 Isoelectric Point 5.53
    Sequence mqkklmhvgpsftsyriqmagvsentgfaspdfldamkyslegllyvagaddsympfilpgsgtvamet vtsliprgsktllltngvfgdrwipiltahglqmdvlsadpghavsmadieekleggdyqnlimthvet stgvrmdiegvskiarkhveriivdgvaslgaerediarlgitaiisasqkalgappgaalivasrsal edinefsyffnlknwitpmerylegkngylstepvgvilslnrvfsdirttgleariddhrrlslalne gieaaglkvlaerdlwsntvtavlsdhadeivrrsmdlgiefatgvhpkllgkyfrighmgyvndfdal salsvieraaaqsgekvrigegvrraqqvlydlshgr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch