.
The Open Protein Structure Annotation Network
PDB Keyword
.

355768

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 355768
    Molecular Characteristics
    Source Aeropyrum pernix k1
    Alias Ids TPS91934,14601295 Molecular Weight 22269.32 Da.
    Residues 209 Isoelectric Point 5.90
    Sequence meilerlslgvlqvntyvaaaggeclvvdpggpevlealerlgcrdivvalthghfdhvagvehlaarg avvaahpqtprvaeayadlgvkmgylkgvprisvdvelvdgstlraaglslkaihtpghspdhivlydq arglaftgdlifrgsigrvdialgdgeamarslarivrelprgtrllpghgpettleyeilhnpflqgfnr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch