.
The Open Protein Structure Annotation Network
PDB Keyword
.

355776

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 355776
    Molecular Characteristics
    Source Neisseria meningitidis z2491
    Alias Ids TPS91944,7379708 Molecular Weight 17131.99 Da.
    Residues 147 Isoelectric Point 6.43
    Sequence mvmpvkkveknilvlhgadkmfelvdkvedypnflpwysktevigrngnelkarlfmdymhvrqsfath nrnipgreirmellegpfktlrgtwkfidlgddmckiefnleydfsnavlsalispvfnhlsatlveaf vkeadrrya
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch