.
The Open Protein Structure Annotation Network
PDB Keyword
.

355821

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 355821
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS92012,10176330 Molecular Weight 43809.42 Da.
    Residues 371 Isoelectric Point 4.98
    Sequence mvervassevanrlnewydtikrqdikkaailkhdlqkamddmeedqnvllyynlidsrykllleqyde sgtileslkdqteradtdnllqyyyyffsglyefnmnnfthairlyhkaenhlttipdeiehaefhfql avayqsidqsffsinhaekaldiylkqenyvsrialtqmiiaankldlnqylaaeklykkailiavdsn qtfiellgyynlglcyevqekleqardcfekaldfnfpqenkketylrikymlarvlfkmgflqegvkw fedavqlanetndkiyqvklqiihavyfdqkelsideglkvlkeqslwhdvedlsfiaarfykkegfyq laskyyeeglnaqqkipslyeevgsa
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch