.
The Open Protein Structure Annotation Network
PDB Keyword
.

355832

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 355832
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhi ty2
    Alias Ids TPS92028,16761829 Molecular Weight 35998.92 Da.
    Residues 326 Isoelectric Point 5.22
    Sequence mafisfpprhpsssarlpltlialddwalssitgvdsekyiqgqvtadvsqmteqqhllaahcdakgkm wstlrlfrerdgfawierrsvreaqltelkkyavfskvviapddervllgvagfqaraalanvfselpn senqvvrdgastllwfehpaerfllvtdvatanmlteklhgeaelnnsqqwlaldieagipvidaansg qfipqatnlqalggisfkkgcytgqemvarakfrgankralwllagkasrvpeagedlelqmgenwrrt gailaatqlddgqllvqavmnndleaesvfrvrddantlhivplpyslee
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch