.
The Open Protein Structure Annotation Network
PDB Keyword
.

355849

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 355849
    Molecular Characteristics
    Source Nostoc sp. pcc 7120
    Alias Ids TPS92056,17132311 Molecular Weight 29094.66 Da.
    Residues 263 Isoelectric Point 4.96
    Sequence mkiadlitwfeswanpawceswdncgwqiepgilheearvlvcltptlavmeeaialqanlifahhpli fsppkslrrgeaiadmarlaftknigiysahtnfdqvedgtadvlaqilglkdvapivptqgglgygrv glldpflnlqelltviqtrlappdlifsptadlqqiisrvavlggsgagfisavaetgaeayltsdckf hqfqesrdrglilidaghyaterpacdrlveklrslnlhwvqlsnqdedfrqffvk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch