.
The Open Protein Structure Annotation Network
PDB Keyword
.

356091

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 356091
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS92166,15158914 Molecular Weight 33433.03 Da.
    Residues 305 Isoelectric Point 6.56
    Sequence metgvskarhpldepaypevagrfsdlwrsirhdgmrersdqeqkdlidqirnaldrktsgvsgekpdw iansfavnctayqsettlllqlrhrdlgslhalktvppgsrddavllqrlrdeakiglalrhpclaets allrlpdgrpgllqpwfahslasivstqpiaasqvisilrrvleglsamhalgyvhcdvtpanilladg nfetaklgdfgialrigrkhaeqgmrfagspefaapeqrqgapakpdqdiyavgrlarrliatdeaqsp qrladfaqacchddpalrpqtaaealqll
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch