.
The Open Protein Structure Annotation Network
PDB Keyword
.

356171

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 356171
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS92290,NP_353402.1, 3.40.630.10 Molecular Weight 42544.56 Da.
    Residues 398 Isoelectric Point 5.11
    Sequence mtttdpvanlaalircpsvtpaeggalslldtllsplgfavervmatedgtpdvenlyarlgtegphlm faghtdvvpvgdeaawshppfsadiaggemygrgavdmkggiacfvaaiarhigkhgkpqgsvsflitg deegpsingtskllewaaakgetwdacvvgeptnpdqlgdmikigrrgslsgritvqgvqghaayphla dnpirgllqlthalmhpafdhgtddfqpsnlevttvdtgnaatnviparataafnirfndswtaeslra eiirrldaaanegelrpdrapvkyeivwadrpshvfltrnnalisslsgaietvtgkepklsttggtsd arfikdycpvvefglvgqtmhmvdervavadletltriyetfierwfahadgk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch