.
The Open Protein Structure Annotation Network
PDB Keyword
.

356850

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 356850
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS2480,2636296 Molecular Weight 50971.31 Da.
    Residues 433 Isoelectric Point 5.87
    Sequence maypngklseekvfkdpvhryvhvrdkliwdligtrefqrlrrikqlgttyltfhgaehsrfnhslgvy eivrrmvddvfkgrpewddserelclaaallhdlghgpfshsfekvfhldhedftrgiilgdtevnqvl rkvspgfpqdvaeviaktyknkqvvslissqidadrmdylqrdayytgvsyghfdmerilrvmrpredq ivikesgmhavedyimsryqmywqvyfhpvtrsaeviltkilhrakqlhdegyvfthapvhfysifegk ltledyvkldesiilyyfqawedeedailsdlcrrfinrqlfqyvefnpneemsayfeltslfkeagid psyylvvdsssdlpydfyrpgeeeerlpihlltqngqikelsrqsaivesisgkrrtdhklyypkdlic dgtkhpeakmkirqllglt
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch