.
The Open Protein Structure Annotation Network
PDB Keyword
.

357269

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 357269
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS2525,EF2236 Molecular Weight 69139.60 Da.
    Residues 599 Isoelectric Point 5.10
    Sequence miqprirqnpfetyeevaegfedllaplelffdreyqghldlgthgtvyskgtrdaeaflrplwglgpy vtqneseylndfltgiiegtdpesssywgktkdydqlivemaalstflllnkektwdqltkeqqnnlhs wliqaneniippnnwhffrvllnlamkhcempyskeqiavdlavidrfyvgngwyydgvetqvdyyvsf aihyysllycrfapedtarvaimkeratlfaqefkywftqpgeaipfgrsltyrfaqvsffsalvfadv ealpwgeikglisrhlhqwmnkdifttdgllsvgydyqnmvfaegyngpgspywafktfillavpkdhp ywqaetqpisfpekhlpspesrnyyqvndagthglmfpagqfinyqahahdkyskfvysshfgfstiks dywyyegaydnclalaeddhyfrtkglddqyeilddriihqwhpwsdvaikttivplegqhlriheiet qralvayeggfsiplfdekvtcvsdqmaevknakgvskveningfseaaiirtepntnllypltelpyl kanlskgkhllislvtgvlpneqiepvkvrlkenqllveekvvilgn
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch