.
The Open Protein Structure Annotation Network
PDB Keyword
.

357274

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 357274
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS2527,EF2644 Molecular Weight 32766.22 Da.
    Residues 300 Isoelectric Point 4.53
    Sequence mkkavlivnpssggekakefetlaeeklkqlfdevvvkqtekggdaeqfareaaeshfdsvfvmggdgt vnegisglaeqayrpkfgffplgtvndlaralnlpmdpeeaiqqldlektsaldvgkinddyfmnvvai gtipesindvdveqktklgklayfisgakhlanaqtypfhlsldqkeqtiesstvlvgltnsiggfetl lpeaqvddgklhlvylkdqslwdavkavpdllkgvdqstdnlvyltfkegtislenqeelttnvdgdeg aalpitlkilpkhltvycgeeqtk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch