.
The Open Protein Structure Annotation Network
PDB Keyword
.

357477

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 357477
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS2547,1591328, 283167, 282619 Molecular Weight 21867.26 Da.
    Residues 195 Isoelectric Point 5.51
    Sequence meytfnkltkkdvkklkvgdivylngkiytardeahlkiiemlksneklpfdlnesiiyhagpimkkvn dswvcvsigpttsarmndveeefikltnisaivgkggmkkellktfedygvvylaapggcaallansvk rvdnvyfldelgmpeavwelevnnfgplivamdshgnsiyeevnkkvyeklneligl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch