.
The Open Protein Structure Annotation Network
PDB Keyword
.

357522

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 357522
    Molecular Characteristics
    Source Neisseria meningitidis z2491
    Alias Ids TPS2554,7380330 Molecular Weight 17715.13 Da.
    Residues 153 Isoelectric Point 9.48
    Sequence mkpqkslraramdilsrqelsriglkrklaphaeseeelenvlnefaernwqsdlryaeayirsksrkh gslrlkqalaqqgideetsrnllpdrsseklaaiavlrkkfkhpaadlkekqkqarflayrgfdadtvq talkhawdenwedgc
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch