The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 357983
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mw2
    Alias Ids TPS2592,NP_647147.1, RER070207002690, 282779, 89859 Molecular Weight 9433.12 Da.
    Residues 83 Isoelectric Point 4.55
    Sequence miiknysyarqnlkalmtkvnddsdmvtvtstddknvvimsesdynsmmetlylqqnpnnaehlaqsia dlergktitkdidv
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch