The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 358447
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2678,TM0986 Molecular Weight 33832.61 Da.
    Residues 294 Isoelectric Point 5.05
    Sequence rvefsggtfvlknvqdifvplevrgakvecsknfvleengvlikqvrpgetvtlhfesggifrvkkelk iearaseedsdgdgypdsleldsedserfrnwfvwialsafkndpllwpkeerdcsgfvrycarealkk htgswfslsgyngpvwedvekynypnlplvgtkmfriekgayrgvedfsnfavarilvecsmefvtksv sealpgdiavffhpedvempyhlmifvgnlnladhegwfvyhtgpigenpgelrfvryselvnydpswa pleinpyflgfyrfrflk
      BLAST   FFAS

    Ligand Information
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch