The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 358462
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2680,TM1199 Molecular Weight 70207.83 Da.
    Residues 606 Isoelectric Point 5.30
    Sequence prektlilpflfaplpapgnwnlwagwraqncglhqfvteplwtinpnpeeggiinalaaeppiynedf tkltiklrkgiywsdgveftaddvvftiktvkdtsgldyhgpmqdvkdvyaldkytvvvelkrpnsrfh ayfverwgalrpmpkhifekvedvvsfdfnppvslgpyvlkdydpagywvlwekrkdwqrtvtgqlfge pvpeyvlfinygtpekntmamlrheldvlqgsaeqlitllrmskttrsyrktwpyidprdistrgpgfn hmvypynikdvrwalalsidivklaistydgmvamtpglplvvnknfyewyfkrlepwleeltldlgng etfkpwdpkapwrllewakkmykvdidpnseeevrltlgygwwkyapdaaekllkkhgfyrdengkwhl pngdlwkitilrgpdptdmaniiiegiaeqwkefgievvfnvssaastlagegrfevvntahggfagep wgfhpdlyrcfnafrsefvkpigeltlgsalrwsdprmdkiieelektdwndyekvielgveglkleie emvaipvfncpitivfdeyywtnfpspendyarcdnfttwpqlkyllhmvkpak
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1199

    Name: lactose transport via ABC system (import)
    Other genes that carryout this rxn:TM1197 TM1198 TM1196 TM1194
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + lcts[e] --> adp[c] + h[c] + lcts[c] + pi[c]


    Ligand Information
    Model TM1199
    generated 12/2008
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch