.
The Open Protein Structure Annotation Network
PDB Keyword
.

358628

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 358628
    Molecular Characteristics
    Source Deinococcus radiodurans r1
    Alias Ids TPS25601,6459539 Molecular Weight 23867.01 Da.
    Residues 219 Isoelectric Point 6.33
    Sequence mpgqaavstaagqktvkrkvnslgypllmpttqprlsflavptednahegvkklwskaeanmgfvpnvf raqalngeqflawwnyfnllvnkegglsnaerellavvvsglnrcvycavshgaalrefsgdavkadav avnwrqaelsereqamcayaekltlrpaemteadlaplraaglsdeaileavqviamfnmtnrvssalg fvpnpeyhiqsr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch