.
The Open Protein Structure Annotation Network
PDB Keyword
.

358815

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 358815
    Molecular Characteristics
    Source Helicobacter pylori 26695
    Alias Ids TPS71962,2313752 Molecular Weight 19576.74 Da.
    Residues 178 Isoelectric Point 5.17
    Sequence msqkililgignilfgdegigvhlahylkknfsffpsvdiidggtmaqqliplitsyekvlildcvsae gveigsvyafdfkdapkeitwagsahevemlhtlrlteflgdlpktfivglvpfvigsettfklsskil naletalkaietqlnawgvkmqrtdhialeciaelsykgf
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch