.
The Open Protein Structure Annotation Network
PDB Keyword
.

358884

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 358884
    Molecular Characteristics
    Source Campylobacter jejuni subsp. jejuni nctc 11168
    Alias Ids TPS25627,6967919 Molecular Weight 40513.43 Da.
    Residues 365 Isoelectric Point 5.58
    Sequence mfgskinhsdlqkleeenknlthkiekfqsenlelknkitsleqaalesklktdllnvlltgvlkniti iqgdmlenvnkaevissysktslaemdelnhiansinaslgnitesanktrdvagtlhrsvdeitnvin likdvsdqtnllalnaaieaaragehgrgfavvadevrklaektqkattevemninllkqnanemytqs eqvekisidsnahimsfsekfthlvneahstnsnavgiaseafvslakldhiafklngykeifsksgkq ladhtscrlgkwlastgkerfgqnksflkinephekvhenmnnaitiantediskditqhsiinkceva enasldlfnvfkemldesdh
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch