.
The Open Protein Structure Annotation Network
PDB Keyword
.

360287

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 360287
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26146,TM0259 Molecular Weight 32448.67 Da.
    Residues 287 Isoelectric Point 5.31
    Sequence slrsgervkkaleklgyehtvfdvredflkkvdqlksfdvvfnvlhgtfgedgtlqaildflgirytgsd afssmicfdklvtyrflkgtveipdfveikefmktsplgypcvvkprregssigvfvcesdeefqhalk edlprygsvivqkyipgremtvsiletekgfeilpvlelrpkrrfydyvakytkgetefilpaplnpse erlvkemalkafveagcrgfgrvdgifsdgrfyfleintvpgltetsdlpasakaggiefeelveiilk saflkegvrv
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0259

    Name: D-alanine-D-alanine ligase (reversible)
    Metabolic Subsystem: Peptidoglycan Biosynthesis
    Reaction: : ala-D + atp <==> adp + alaala + h + pi
    Classification: EC:6.3.2.4
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0259
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch