.
The Open Protein Structure Annotation Network
PDB Keyword
.

360296

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 360296
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS25639,TM0693 Molecular Weight 10209.23 Da.
    Residues 86 Isoelectric Point 8.26
    Sequence eierkideaiekedyetllsllnkrkelmeglpkdklseilekdrkrleiiekrktalfqeinvirear sslqkniwtrgdtlgrg
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch