.
The Open Protein Structure Annotation Network
PDB Keyword
.

361357

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 361357
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS6092,NP_388966.2, PF05163, 90310 Molecular Weight 19486.88 Da.
    Residues 169 Isoelectric Point 5.74
    Sequence mtdakqfydyhswankkifthienlpeetayqevksvfpsvsdvllhmcradyiwlnvlsgvayqeiid sagklqsaqgnmaaikqhaaelesqyhdffsrqtdleqtftmqhpklgtlestyadtilhvvnhgtyhr gnvtamlrqldhsgvptdymyylyekreskg
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch