.
The Open Protein Structure Annotation Network
PDB Keyword
.

361640

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 361640
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS6107,16420133 Molecular Weight 20193.87 Da.
    Residues 182 Isoelectric Point 5.06
    Sequence rthsdvlaaakvvapgrtldlgcgngrnslylaangydvtawdknpasmanlerikaaegldnlqtdlv dlntltfdgeydfilstvvmmfleaqtipglianmqrctkpggynlivaamdtpdfpctvgfpfafkeg elrryyegwdmlkynedvgelhrtdengnriklrfatmlarkta
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch