.
The Open Protein Structure Annotation Network
PDB Keyword
.

366990

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 366990
    Molecular Characteristics
    Source Ralstonia eutropha jmp134
    Alias Ids TPS6264,YP_298765.1, 2.60.120.10, 90881 Molecular Weight 18585.11 Da.
    Residues 168 Isoelectric Point 5.52
    Sequence mtlpatithqeklltvdttahpflkalgghegtdifplfmdpynglmvmrasfapgltlplhfhtgtvh mytisgcwyyteypgqkqtagcylyepggsihqfntprdnegqtevifmlsgcnvnftqdgtylglsda gviknwvdraireqdnglryiaaavptyaa
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary

    Protein with a cupin-like fold and unknown function (Genbank:YP_298765) is similar to alpha subunit of putative acetyl/propionyl-CoA carboxylase (PDB code 1o1q, Fig. 1). Several conserved residues in YP_298765 (Fig. 2) cluster around the unknown ligand binding cleft (Fig. 3). Some of the conserved residues in  YP_298765 are different than in putative acetyl/propionyl-CoA carboxylase, indicating that YP_298765 have different function. The side chains of His62 and Phe117 could be involve in stacking interactions with aromatic ring of the ligand, but so far the ligand remains unknown.


    Figure 1. Structural superposition between YP298765 (green) and putative acetyl/propionyl-CoA carboxylase (PDB code 1o1q, red).



    Figure 2. Score calculated from the number of invariant residues in all PSI-BLAST hits (top line) and top 10 PSI-BLAST hits (second line). The highest score indicating sequence conservation is highlighted by red.
     
     




    Figure 3. Cross section of YP298765 dimer. The conserved residues and unknown ligand are shown as sticks (chain A only). Aromatic residues such as Trp77 (not shown) and Phe117 correspond to Met74 and Met114 in PDB:1o1q. The amino acid properties are indicated by different colors.


    To do: (a) analyze all possible ligands starting with compounds from gentisate pathway, tryptophan metabolism, 2-nitrobenzoate degradation pathway, and 3-hydroxyanthranilate; (b) calculate the sequence alignment and conservation profile to update Fig. 2 and 3; (c) identify homologs with strong similarity within the N- and C-terminal part of the protein (to predict substrate specificity).




     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch