.
The Open Protein Structure Annotation Network
PDB Keyword
.

367066

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 367066
    Molecular Characteristics
    Source Xanthomonas campestris pv. campestris str. atcc 33913
    Alias Ids TPS6276,NP_637619.1, 90494, 90799 Molecular Weight 17748.21 Da.
    Residues 162 Isoelectric Point 5.32
    Sequence madpkelqdkfwkalksdrtvmlgldgvedgharpmtaqiegdsggpiwfftskdnaliamlgqgrrvi gafsskghdlfasisgslredtdpavvdrlwnpyvaawyeggkddpklallrldadhaqiwlngsslla gikvllgvdpkkdyqdkvadvplr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary

    This target, NP_637619.1, is a general stress protein from Xanthomonas campestris. A PFAM assignment of this protein can not be made on the basis of its sequence yet.

    The core of the protein is a half-closed b-barrel. The b-barrel is nearly closed by a helix which is oriented at an angle (Fig 1). The overall structure resembles that of a FMN-binding split barrel fold protein. However, there is no FMN or any ligand bound at the FMN binding site.

    Fig 1. The monomer structure consists of a core split-barrel domain.

    There are three monomers in crystallographic asu which form a hexamer as a biological unit. The c-terminal region is involved in the oligomerization (Fig 2).

    Fig 2. Hexameric organization of the oligomer.

    There are several structural homologs of the protein: 1axj 1ci0 1g76 1nrg 1rfe 1t9m 1ty9 1vl7 1w3o 1w9a 1xhn 2a2j 2arz 2asf 2fg9 2fhq 2fur 2hhz 2hq7 2hq9 2htd 2hti 2i02 2i51 2iab 2ig6 2ol5 2ou5 2q9k 2qea 2re7 3ba3. Fig 3 shows the alignment of a few proteins on this traget.

    Fig 3. Superposition of NP_637619.1 (red) on a few of the structural homologs: 1axj (cyan), 2hq7 (yellow),  2qea (green), and 2re7(blue).

    The b-barrel core is the aligning template. Most of these proteins have the FMN-binding split barrel fold. It's possible that this target could bind FMN or FAD in order to perform its function. In that case this protein may belong to PFAM PF01243 or PF01613.


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch