The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 367405
    Molecular Characteristics
    Alias Ids TPS6309,JCVI_PEP_1096694007639 Molecular Weight 16280.79 Da.
    Residues 142 Isoelectric Point 4.66
    Sequence scnavakyfpdfefawllpefedvadieldfvqervnadrmrellsetsnvyvprvindlsgrrvltme yvrgervddfetlskmsidpkfvaskmcevfgdmmfvhglvhcdphpgnllvrkdsngeaqlvvldhgm yvlc
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch