.
The Open Protein Structure Annotation Network
PDB Keyword
.

367475

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 367475
    Molecular Characteristics
    Source Unknown
    Alias Ids TPS6314,JCVI_PEP_1096686650277 Molecular Weight 11404.72 Da.
    Residues 103 Isoelectric Point 5.75
    Sequence mknikimrlvtgediignisesqglitikkafviipmqatpgkpvqlvlspwqpytddkeividdskvi titspkddiiksyeshtseiitpsglitetkipk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary

    The Sm-like protein (ECX21941.1) sequence conservation is different than in structurally similar proteins. Its gene is observed in the neighborhood of genes encoding ribosomal protein S6 modification protein, ferredoxin, and DNA ploymerase.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (1)

    FileSizeDateAttached by 
    GN7729A-latest-pzk.pse.bz2
    No description
    2.69 MB19:21, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch