The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 367785
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS6342,NP_390042.1, BIG_234, BIG_914, BIG_12, 86285 Molecular Weight 21533.11 Da.
    Residues 185 Isoelectric Point 4.39
    Sequence mtnfvhktvnglkslldekgaiqlfcsegdimeflvtfspdkatlndiqsfeakhqlslpedyqkfitl hngakifeilsdgeniggglqlfsleeieeelkyedlfegingipigylleechlmidkdkinqgdpny lyifesgleynplnlnfeifldryilangepfwdwryytaenyyrtr
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch