.
The Open Protein Structure Annotation Network
PDB Keyword
.

369523

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 369523
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS6399,BC031719 Molecular Weight 20689.61 Da.
    Residues 184 Isoelectric Point 8.10
    Sequence mtstpnmsdisckkrddylewpeyfmavaflsaqrskdpssqvgacivntenkivgigyngmpngcsdd llpwrrtaenkldtkypyvchaelnaimnknsadvkgcsmyvalfpcnecakliiqagikevifmsdky hdseettaarllfklagvtfrkftpkyskividfdsinsrpsqkpq
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch