.
The Open Protein Structure Annotation Network
PDB Keyword
.

370204

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 370204
    Molecular Characteristics
    Source Corynebacterium glutamicum atcc 13032
    Alias Ids TPS6419,NP_600758.1, 291461, 103321, 103298 Molecular Weight 23819.35 Da.
    Residues 224 Isoelectric Point 4.55
    Sequence malmtnktralligghgkvallatpmlidasvqvtsmyrnpdhrseiealgattlerdvttlsvedwad llkdfdvvvwsagnggkngadatyaidrdaaiasidgaaslgekapryimvsyigssthtidpsasfyp yaeskkaadehlsstnldylilapaaltldevngveviadtneaaagrttsrvlvaevitefvvrdfpq trvlpfvdgespvssis
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch