.
The Open Protein Structure Annotation Network
PDB Keyword
.

371698

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystal Structure
    Target Id 371698
    Molecular Characteristics
    Source Staphylococcus epidermidis atcc 12228
    Alias Ids TPS6516,NP_765517.1, 2.30.110.10, 103530 Molecular Weight 17807.28 Da.
    Residues 154 Isoelectric Point 4.78
    Sequence mcdkdiynnkemiilnkqqvtkaiekvlnsskigvlstahhnkpnsrymvfynddlnlytktnvnslkv eeiennpdahillgynettnnsfveidatievvkdqkvidwlwetqdktffnskedpelcvlkviprsi klmnddeldtpatiel
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch