.
The Open Protein Structure Annotation Network
PDB Keyword
.

371825

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 371825
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS6537,10175676 Molecular Weight 24767.61 Da.
    Residues 211 Isoelectric Point 4.79
    Sequence rqmvedsptyikeplseeldlketyddinerdsleqwhflqqmrkhnnpadirtllsfvesesndpalr syalhmltmhkvekrvrirkfdqeaevipvelnadeqqrfgnavveqlearlavenpslfkmaeqlwwq flyalypftpkpeqkdlwagavhvavhesnglpfdeeeiagmyncrvqqmlekgeeihfvetetfqgis ghsf
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch