The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 371919
    Molecular Characteristics
    Source Jannaschia sp. ccs1
    Alias Ids TPS6557,JANN_22DEC04_CONTIG26_REVISED_GENE2400, PF06262, 292243 Molecular Weight 16638.89 Da.
    Residues 147 Isoelectric Point 4.33
    Sequence lplscapdfvhivhmhadltapdlaaietlayaardalqepwatparavvirvedvadpqilaelemqd pfeltglydgipmtqksvmdmpeqpdtiwlfrraildewadrgnvtlselvthvlvhefahhfgwsddd iaavdrwwd
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch