.
The Open Protein Structure Annotation Network
PDB Keyword
.

372124

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 372124
    Molecular Characteristics
    Source Streptococcus mutans ua159
    Alias Ids TPS30438,SMU.1453C Molecular Weight 29732.56 Da.
    Residues 259 Isoelectric Point 4.31
    Sequence dtegltevareklleasqisqeplvifglaeiemnlsdfqaaiqhyaqldnraileetgvstyerigra yaslgkfetaieflekaveiefdettvfevatllydqeeyqranlyfkqldsmnpdfagyeynyalslh aehqtkqalrmlqqglsknefdsqllllasqlsyelhdkkaaenyllkvletaeddeealmrlsnlyle enrfedvinldradidsvltkwniakayqkleadtkaleiydtlivdladnp
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch