.
The Open Protein Structure Annotation Network
PDB Keyword
.

372125

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction
    Target Id 372125
    Molecular Characteristics
    Source Streptococcus mutans
    Alias Ids TPS6577,SMU.1453C Molecular Weight 31423.57 Da.
    Residues 271 Isoelectric Point 4.45
    Sequence areklleasqisqeplvifglaeiemnlsdfqaaiqhyaqldnraileetgvstyerigrayaslgkfet aieflekaveiefdettvfevatllydqeeyqranlyfkqldsmnpdfagyeynyalslhaehqtkqal rmlqqglsknefdsqllllasqlsyelhdkkaaenyllkvletaeddeealmrlsnlyleenrfedvin ldradidsvltkwniakayqkleadtkaleiydtlivdladnpdflkdyiyilrkfgydekvk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch