.
The Open Protein Structure Annotation Network
PDB Keyword
.

372630

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 372630
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS6603,YP_322806.1, BIG_581, BIG_343, BIG_146, 92505 Molecular Weight 34772.39 Da.
    Residues 316 Isoelectric Point 5.23
    Sequence msetypilihlgeklnrvivgqsqliqqllvgllsgghiilegvpgtgktllvkvlarliqadfhrvql tpdvlpsditgtnifdlnnrnftlkkgpvftevlladeinrtppktqaalleameemqvtldgeslplp dlfwviatqnplefegtyplpeaqldrflfklvvdypdqtaekqmllnrqagfaarrsdinslqpiatv tdilearqavkavkvsesiidyllalvrtsrqypdlalgaspraagawlqtsqavawlegrdfvtpddi kavaspllrhrlilkpeamldglqidaviaavvnqvavpr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch