The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 373706
    Molecular Characteristics
    Source Shewanella amazonensis sb2b
    Alias Ids TPS6652,SAMA_14OCT04_CONTIG102_REVISED_GENE851 Molecular Weight 17116.65 Da.
    Residues 148 Isoelectric Point 4.64
    Sequence liseevftrelwqaceahyslheslclslqddcqinvnllllaseldrrgtglnqsqwqmlivevaawd erligpyrrlrqlaknslsedeyrqmldvelmmerkvqnlllhrlnqlptsqgeadnlmlllaefgldi evaaalihqd
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch