.
The Open Protein Structure Annotation Network
PDB Keyword
.

373901

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 373901
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS6679,1592102 Molecular Weight 18610.80 Da.
    Residues 162 Isoelectric Point 4.81
    Sequence mafmekifpdileairneeiikeskkipmpyfglfalvifdkvkelgsetslyeigeefgkmlspknie elkkifklmnfgdleidenkillknppykiklsnppyqwvskeepihdfiagilagcleeifaaafvvn evecvsqgkdkcvfevkevdelnk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch